SCOPe 2.05: Domain d2byxb1: 2byx B:1-253

Lineage for d2byxb1 (2byx B:1-253)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein automated matches [231410] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254877] (6 PDB entries)

8. Domain d2byxb1: 2byx B:1-253 [129508]
   Other proteins in same PDB: d2byxa2, d2byxb2, d2byxc2, d2byxd2
   automated match to d2bywa1
   complexed with dao, nh4; mutant

Details for d2byxb1

PDB Entry: 2byx, 2 Å

PDB Description: kas i lys328ala mutant in complex with fatty acid

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byxb1:

Sequence; same for both SEQRES and ATOM records:

>d2byxb1 c.95.1.1 (B:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

Timeline for d2byxb1:

• d2byxb1 first appeared in SCOP 1.73
  
• d2byxb1 appears in SCOPe 2.04
  
• d2byxb1 appears in SCOPe 2.06
  
• d2byxb1 appears in the current release, SCOPe 2.08