Lineage for d2byfa1 (2byf A:1-116)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1195304Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1195332Protein Phospholipase C-epsilon-1 [142966] (1 species)
    contains several Ras-binding domains; some are 'hidden' in the sequence
  7. 1195333Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
    Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239
  8. 1195335Domain d2byfa1: 2byf A:1-116 [129479]

Details for d2byfa1

PDB Entry: 2byf (more details)

PDB Description: nmr solution structure of phospholipase c epsilon ra 2 domain
PDB Compounds: (A:) phospholipase c, epsilon 1

SCOPe Domain Sequences for d2byfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byfa1 d.15.1.5 (A:1-116) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
sseeesffvqvhdvspeqpltvikaprvstaqdviqqtlckakysysilsnpnpsdyvll
eevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk

SCOPe Domain Coordinates for d2byfa1:

Click to download the PDB-style file with coordinates for d2byfa1.
(The format of our PDB-style files is described here.)

Timeline for d2byfa1: