SCOPe 2.04: Domain d2by5x_: 2by5 X:

Lineage for d2by5x_ (2by5 X:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187001] (12 PDB entries)

8. Domain d2by5x_: 2by5 X: [129466]
   automated match to d1tgsz_
   complexed with bam, ca, gol, so4

Details for d2by5x_

PDB Entry: 2by5, 1.3 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection

PDB Compounds: (X:) cationic trypsin

SCOPe Domain Sequences for d2by5x_:

Sequence; same for both SEQRES and ATOM records:

>d2by5x_ b.47.1.2 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2by5x_:

• d2by5x_ first appeared in SCOP 1.73, called d2by5x1
  
• d2by5x_ appears in SCOPe 2.03
  
• d2by5x_ appears in SCOPe 2.05
  
• d2by5x_ appears in the current release, SCOPe 2.08