Lineage for d2by3a2 (2by3 A:531-602)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077123Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)
  7. 2077124Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries)
    Uniprot Q9RX51 529-600
  8. 2077130Domain d2by3a2: 2by3 A:531-602 [129464]
    Other proteins in same PDB: d2by3a1, d2by3a3
    automated match to d2bhua2
    complexed with bme, glc, mg, tre, trs

Details for d2by3a2

PDB Entry: 2by3 (more details), 1.5 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2by3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2by3a2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]}
qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred
ltlgageavlvg

SCOPe Domain Coordinates for d2by3a2:

Click to download the PDB-style file with coordinates for d2by3a2.
(The format of our PDB-style files is described here.)

Timeline for d2by3a2: