SCOPe 2.03: Domain d2by0a1: 2by0 A:14-110

Lineage for d2by0a1 (2by0 A:14-110)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
   domain architecture similar to isoamylase

7. Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)
   Uniprot Q9RX51 14-110

8. Domain d2by0a1: 2by0 A:14-110 [129454]
   Other proteins in same PDB: d2by0a2, d2by0a3
   automated match to d2bhua1
   complexed with bme, glc, mg, tre, trs

Details for d2by0a1

PDB Entry: 2by0, 1.55 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2by0a1:

Sequence; same for both SEQRES and ATOM records:

>d2by0a1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

Timeline for d2by0a1:

• d2by0a1 first appeared in SCOP 1.73
  
• d2by0a1 appears in SCOPe 2.02
  
• d2by0a1 appears in SCOPe 2.04
  
• d2by0a1 appears in the current release, SCOPe 2.08