Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries) Uniprot Q9RX51 14-110 |
Domain d2bxza1: 2bxz A:14-110 [129451] Other proteins in same PDB: d2bxza2, d2bxza3 automated match to d2bhua1 complexed with bme, glc, mg, tre, trs |
PDB Entry: 2bxz (more details), 1.75 Å
SCOPe Domain Sequences for d2bxza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxza1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg
Timeline for d2bxza1: