SCOP 1.73: Domain d2bxza1: 2bxz A:14-110

Lineage for d2bxza1 (2bxz A:14-110)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
   domain architecture similar to isoamylase

7. Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)

8. Domain d2bxza1: 2bxz A:14-110 [129451]
   Other proteins in same PDB: d2bxza2, d2bxza3
   automatically matched to 2BHU A:14-110
   complexed with bme, glc, mg, tre, trs

Details for d2bxza1

PDB Entry: 2bxz, 1.75 Å

PDB Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOP Domain Sequences for d2bxza1:

Sequence; same for both SEQRES and ATOM records:

>d2bxza1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

Timeline for d2bxza1:

• d2bxza1 is new in SCOP 1.73
  
• d2bxza1 appears in SCOP 1.75
  
• d2bxza1 appears in the current release, SCOPe 2.08