Class a: All alpha proteins [46456] (285 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries) |
Domain d2bxqa1: 2bxq A:197-388 [129443] automated match to d4l8ua2 complexed with imn, myr, p1z |
PDB Entry: 2bxq (more details), 2.6 Å
SCOPe Domain Sequences for d2bxqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxqa1 a.126.1.0 (A:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde fkplveepqnli
Timeline for d2bxqa1: