SCOPe 2.06: Domain d2bxka1: 2bxk A:197-388

Lineage for d2bxka1 (2bxk A:197-388)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)

8. Domain d2bxka1: 2bxk A:197-388 [129431]
   automated match to d4l8ua2
   complexed with azq, imn, myr

Details for d2bxka1

PDB Entry: 2bxk, 2.4 Å

PDB Description: human serum albumin complexed with myristate, azapropazone and indomethacin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxka1:

Sequence; same for both SEQRES and ATOM records:

>d2bxka1 a.126.1.0 (A:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d2bxka1:

• d2bxka1 first appeared in SCOP 1.73
  
• d2bxka1 appears in SCOPe 2.05
  
• d2bxka1 appears in SCOPe 2.07
  
• d2bxka1 appears in the current release, SCOPe 2.08