SCOPe 2.04: Domain d2bxdb1: 2bxd B:197-388

Lineage for d2bxdb1 (2bxd B:197-388)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)

8. Domain d2bxdb1: 2bxd B:197-388 [129415]
   automated match to d4l8ua2
   complexed with rwf

Details for d2bxdb1

PDB Entry: 2bxd, 3.05 Å

PDB Description: human serum albumin complexed with warfarin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bxdb1:

Sequence; same for both SEQRES and ATOM records:

>d2bxdb1 a.126.1.0 (B:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d2bxdb1:

• d2bxdb1 first appeared in SCOP 1.73
  
• d2bxdb1 appears in SCOPe 2.03
  
• d2bxdb1 appears in SCOPe 2.05
  
• d2bxdb1 appears in the current release, SCOPe 2.08