Lineage for d2bxcb1 (2bxc B:197-388)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730831Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. 2730902Domain d2bxcb1: 2bxc B:197-388 [129411]
    automated match to d4l8ua2
    complexed with p1z

Details for d2bxcb1

PDB Entry: 2bxc (more details), 3.1 Å

PDB Description: human serum albumin complexed with phenylbutazone
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bxcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bxcb1 a.126.1.0 (B:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d2bxcb1:

Click to download the PDB-style file with coordinates for d2bxcb1.
(The format of our PDB-style files is described here.)

Timeline for d2bxcb1: