Lineage for d2bx8b2 (2bx8 B:389-582)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013468Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2013469Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2013470Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
    Uniprot P02768 29-596
  8. 2013694Domain d2bx8b2: 2bx8 B:389-582 [129400]
    automated match to d1n5ua3
    complexed with azq

Details for d2bx8b2

PDB Entry: 2bx8 (more details), 2.7 Å

PDB Description: human serum albumin complexed with azapropazone
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2bx8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx8b2 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

SCOPe Domain Coordinates for d2bx8b2:

Click to download the PDB-style file with coordinates for d2bx8b2.
(The format of our PDB-style files is described here.)

Timeline for d2bx8b2: