SCOP 1.75: Domain d2bwwa1: 2bww A:1-176

Lineage for d2bwwa1 (2bww A:1-176)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (26 PDB entries)

8. Domain d2bwwa1: 2bww A:1-176 [129389]
   Other proteins in same PDB: d2bwwa2
   automatically matched to d1a16_1
   complexed with flc, mg, mn, mrd; mutant

Details for d2bwwa1

PDB Entry: 2bww, 2.61 Å

PDB Description: his350ala escherichia coli aminopeptidase p

PDB Compounds: (A:) aminopeptidase p

SCOP Domain Sequences for d2bwwa1:

Sequence; same for both SEQRES and ATOM records:

>d2bwwa1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d2bwwa1:

• d2bwwa1 first appeared in SCOP 1.73
  
• d2bwwa1 appears in SCOPe 2.01
  
• d2bwwa1 appears in the current release, SCOPe 2.08