Lineage for d2bwfb_ (2bwf B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018301Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1018302Protein automated matches [190233] (4 species)
    not a true protein
  7. 1018303Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (1 PDB entry)
  8. 1018305Domain d2bwfb_: 2bwf B: [129364]
    automated match to d1bt0a_
    complexed with fmt

Details for d2bwfb_

PDB Entry: 2bwf (more details), 1.15 Å

PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae
PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwfb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
syhiqdghsvhlvksqp

SCOPe Domain Coordinates for d2bwfb_:

Click to download the PDB-style file with coordinates for d2bwfb_.
(The format of our PDB-style files is described here.)

Timeline for d2bwfb_: