Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (1 PDB entry) |
Domain d2bwfb_: 2bwf B: [129364] automated match to d1bt0a_ complexed with fmt |
PDB Entry: 2bwf (more details), 1.15 Å
SCOPe Domain Sequences for d2bwfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwfb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve syhiqdghsvhlvksqp
Timeline for d2bwfb_: