Lineage for d2bwes1 (2bwe S:2-74)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637475Protein DSK2 [142940] (1 species)
  7. 1637476Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (1 PDB entry)
    Uniprot P48510 2-74
  8. 1637477Domain d2bwes1: 2bwe S:2-74 [129360]
    Other proteins in same PDB: d2bwea1, d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwet_, d2bweu_

Details for d2bwes1

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (S:) dsk2

SCOPe Domain Sequences for d2bwes1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwes1 d.15.1.1 (S:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

SCOPe Domain Coordinates for d2bwes1:

Click to download the PDB-style file with coordinates for d2bwes1.
(The format of our PDB-style files is described here.)

Timeline for d2bwes1: