![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein DSK2 [142940] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (1 PDB entry) Uniprot P48510 2-74 |
![]() | Domain d2bwes1: 2bwe S:2-74 [129360] Other proteins in same PDB: d2bwea1, d2bweb1, d2bwec1, d2bwed1, d2bwee1, d2bwef1, d2bweg1, d2bweh1, d2bwei1, d2bwej1, d2bwek1, d2bwel1, d2bwem1, d2bwen1, d2bweo1, d2bwep1, d2bweq1, d2bwer1 |
PDB Entry: 2bwe (more details), 3.1 Å
SCOPe Domain Sequences for d2bwes1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwes1 d.15.1.1 (S:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh iqdghsvhlvksq
Timeline for d2bwes1: