Lineage for d2bwer1 (2bwe R:328-371)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1260917Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1260941Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 1260942Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1260961Protein DSK2 [140323] (1 species)
  7. 1260962Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (2 PDB entries)
    Uniprot P48510 328-371! Uniprot P48510 328-373
  8. 1260980Domain d2bwer1: 2bwe R:328-371 [129359]
    Other proteins in same PDB: d2bwes1, d2bwet1, d2bweu1
    automatically matched to 2BWE A:328-371

Details for d2bwer1

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (R:) dsk2

SCOPe Domain Sequences for d2bwer1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwer1 a.5.2.1 (R:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

SCOPe Domain Coordinates for d2bwer1:

Click to download the PDB-style file with coordinates for d2bwer1.
(The format of our PDB-style files is described here.)

Timeline for d2bwer1: