Class a: All alpha proteins [46456] (258 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (4 families) |
Family a.5.2.1: UBA domain [46935] (22 proteins) |
Protein DSK2 [140323] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (3 PDB entries) |
Domain d2bwei1: 2bwe I:328-371 [129350] Other proteins in same PDB: d2bwes1, d2bwet1, d2bweu1 automatically matched to 2BWE A:328-371 |
PDB Entry: 2bwe (more details), 3.1 Å
SCOP Domain Sequences for d2bwei1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwei1 a.5.2.1 (I:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
Timeline for d2bwei1: