Class a: All alpha proteins [46456] (285 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein automated matches [190533] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries) |
Domain d2bweh_: 2bwe H: [129349] Other proteins in same PDB: d2bwea1, d2bwes1, d2bwet_, d2bweu_ automated match to d1wr1b1 |
PDB Entry: 2bwe (more details), 3.1 Å
SCOPe Domain Sequences for d2bweh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bweh_ a.5.2.1 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
Timeline for d2bweh_: