SCOPe 2.06: Domain d2bwba_: 2bwb A:

Lineage for d2bwba_ (2bwb A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)

8. Domain d2bwba_: 2bwb A: [129329]
   automated match to d1wr1b1

Details for d2bwba_

PDB Entry: 2bwb, 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae

PDB Compounds: (A:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwba_:

Sequence; same for both SEQRES and ATOM records:

>d2bwba_ a.5.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

Timeline for d2bwba_:

• d2bwba_ first appeared in SCOP 1.73, called d2bwba1
  
• d2bwba_ appears in SCOPe 2.05
  
• d2bwba_ appears in SCOPe 2.07
  
• d2bwba_ appears in the current release, SCOPe 2.08