Lineage for d2bw9m1 (2bw9 M:1-153)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759674Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
    Uniprot P02185
  8. 759758Domain d2bw9m1: 2bw9 M:1-153 [129326]
    automatically matched to d1ltw__
    complexed with cmo, hem; mutant

Details for d2bw9m1

PDB Entry: 2bw9 (more details), 1.68 Å

PDB Description: laue structure of l29w mbco
PDB Compounds: (M:) Myoglobin

SCOP Domain Sequences for d2bw9m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw9m1 a.1.1.2 (M:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d2bw9m1:

Click to download the PDB-style file with coordinates for d2bw9m1.
(The format of our PDB-style files is described here.)

Timeline for d2bw9m1: