Lineage for d2bw3b1 (2bw3 B:79-158)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509800Fold a.270: Hermes dimerisation domain [140995] (1 superfamily)
    multihelical, intertwinned dimer of two 4-helical strings
  4. 1509801Superfamily a.270.1: Hermes dimerisation domain [140996] (1 family) (S)
    automatically mapped to Pfam PF10683
  5. 1509802Family a.270.1.1: Hermes dimerisation domain [140997] (1 protein)
  6. 1509803Protein Transposase Hermes, dimerisation domain [140998] (1 species)
  7. 1509804Species House fly (Musca domestica) [TaxId:7370] [140999] (1 PDB entry)
    Uniprot Q25442 79-158! Uniprot Q25442 79-162
  8. 1509806Domain d2bw3b1: 2bw3 B:79-158 [129319]
    Other proteins in same PDB: d2bw3a2

Details for d2bw3b1

PDB Entry: 2bw3 (more details), 2 Å

PDB Description: three-dimensional structure of the hermes dna transposase
PDB Compounds: (B:) transposase

SCOPe Domain Sequences for d2bw3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw3b1 a.270.1.1 (B:79-158) Transposase Hermes, dimerisation domain {House fly (Musca domestica) [TaxId: 7370]}
qsrelktvsadckkeaiekcaqwvvrdcrpfsavsgsgfidmikffikvgaeygdhvnve
ellpspitlsrkvtsdakek

SCOPe Domain Coordinates for d2bw3b1:

Click to download the PDB-style file with coordinates for d2bw3b1.
(The format of our PDB-style files is described here.)

Timeline for d2bw3b1: