SCOPe 2.04: Domain d2bw3a1: 2bw3 A:79-162

Lineage for d2bw3a1 (2bw3 A:79-162)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.270: Hermes dimerisation domain [140995] (1 superfamily)
   multihelical, intertwinned dimer of two 4-helical strings

4. Superfamily a.270.1: Hermes dimerisation domain [140996] (1 family)
   automatically mapped to Pfam PF10683

5. Family a.270.1.1: Hermes dimerisation domain [140997] (1 protein)

6. Protein Transposase Hermes, dimerisation domain [140998] (1 species)

7. Species House fly (Musca domestica) [TaxId:7370] [140999] (1 PDB entry)
   Uniprot Q25442 79-158! Uniprot Q25442 79-162

8. Domain d2bw3a1: 2bw3 A:79-162 [129317]
   Other proteins in same PDB: d2bw3a2

Details for d2bw3a1

PDB Entry: 2bw3, 2 Å

PDB Description: three-dimensional structure of the hermes dna transposase

PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2bw3a1:

Sequence; same for both SEQRES and ATOM records:

>d2bw3a1 a.270.1.1 (A:79-162) Transposase Hermes, dimerisation domain {House fly (Musca domestica) [TaxId: 7370]}
qsrelktvsadckkeaiekcaqwvvrdcrpfsavsgsgfidmikffikvkaeygehvnve
ellpspitlsrkvtsdakekkali

Timeline for d2bw3a1:

• d2bw3a1 first appeared in SCOP 1.73
  
• d2bw3a1 appears in SCOPe 2.03
  
• d2bw3a1 appears in SCOPe 2.05
  
• d2bw3a1 appears in the current release, SCOPe 2.08