SCOP 1.73: Domain d2bvnb2: 2bvn B:297-392

Lineage for d2bvnb2 (2bvn B:297-392)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)

8. Domain d2bvnb2: 2bvn B:297-392 [129286]
   Other proteins in same PDB: d2bvna1, d2bvna3, d2bvnb1, d2bvnb3
   automatically matched to d1d8ta2
   complexed with enx, gnp, mg

Details for d2bvnb2

PDB Entry: 2bvn, 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia

PDB Compounds: (B:) elongation factor tu

SCOP Domain Sequences for d2bvnb2:

Sequence; same for both SEQRES and ATOM records:

>d2bvnb2 b.44.1.1 (B:297-392) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvl

Timeline for d2bvnb2:

• d2bvnb2 is new in SCOP 1.73
  
• d2bvnb2 appears in SCOP 1.75
  
• d2bvnb2 appears in the current release, SCOPe 2.08