Lineage for d2bvna3 (2bvn A:9-204)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830208Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 830215Species Escherichia coli [TaxId:562] [52627] (9 PDB entries)
    Uniprot P02990
  8. 830222Domain d2bvna3: 2bvn A:9-204 [129284]
    Other proteins in same PDB: d2bvna1, d2bvna2, d2bvnb1, d2bvnb2
    automatically matched to d1ob2a3
    complexed with enx, gnp, mg

Details for d2bvna3

PDB Entry: 2bvn (more details), 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia
PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d2bvna3:

Sequence, based on SEQRES records: (download)

>d2bvna3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d2bvna3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
kphvnvgtighvdhgkttltaaittvlaktyggekargitintshveydtptrhyahvdc
pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd
deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe
per

SCOP Domain Coordinates for d2bvna3:

Click to download the PDB-style file with coordinates for d2bvna3.
(The format of our PDB-style files is described here.)

Timeline for d2bvna3: