Lineage for d2bvna2 (2bvn A:297-393)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792477Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1792505Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1792512Species Escherichia coli [TaxId:562] [50468] (8 PDB entries)
    Uniprot P02990
  8. 1792521Domain d2bvna2: 2bvn A:297-393 [129283]
    Other proteins in same PDB: d2bvna1, d2bvna3, d2bvnb1, d2bvnb3
    automated match to d1efca2
    complexed with enx, gnp, mg

Details for d2bvna2

PDB Entry: 2bvn (more details), 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d2bvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvna2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d2bvna2:

Click to download the PDB-style file with coordinates for d2bvna2.
(The format of our PDB-style files is described here.)

Timeline for d2bvna2: