Class b: All beta proteins [48724] (174 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Escherichia coli [TaxId:562] [50468] (7 PDB entries) Uniprot P02990 |
Domain d2bvna2: 2bvn A:297-392 [129283] Other proteins in same PDB: d2bvna1, d2bvna3, d2bvnb1, d2bvnb3 automatically matched to d1d8ta2 complexed with enx, gnp, mg |
PDB Entry: 2bvn (more details), 2.3 Å
SCOPe Domain Sequences for d2bvna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvna2 b.44.1.1 (A:297-392) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvl
Timeline for d2bvna2: