SCOPe 2.05: Domain d2bveb_: 2bve B:

Lineage for d2bveb_ (2bve B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d2bveb_: 2bve B: [129257]
   automated match to d1qfoa_
   complexed with ph5

Details for d2bveb_

PDB Entry: 2bve, 2.2 Å

PDB Description: structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac

PDB Compounds: (B:) sialoadhesin

SCOPe Domain Sequences for d2bveb_:

Sequence; same for both SEQRES and ATOM records:

>d2bveb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

Timeline for d2bveb_:

• d2bveb_ first appeared in SCOP 1.73, called d2bveb1
  
• d2bveb_ appears in SCOPe 2.04
  
• d2bveb_ appears in SCOPe 2.06
  
• d2bveb_ appears in the current release, SCOPe 2.08