Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein N-terminal domain of sialoadhesin [48732] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48733] (7 PDB entries) |
Domain d2bvea1: 2bve A:1-111 [129256] automatically matched to d1od7a_ complexed with ph5 |
PDB Entry: 2bve (more details), 2.2 Å
SCOP Domain Sequences for d2bvea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvea1 b.1.1.1 (A:1-111) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkg
Timeline for d2bvea1: