Lineage for d2bvce2 (2bvc E:105-478)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733061Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 733062Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 733063Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 733064Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 733065Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries)
  8. 733070Domain d2bvce2: 2bvc E:105-478 [129252]
    Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
    automatically matched to d1htoa2
    complexed with adp, cl, mg, p3s

Details for d2bvce2

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (E:) glutamine synthetase 1

SCOP Domain Sequences for d2bvce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvce2 d.128.1.1 (E:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOP Domain Coordinates for d2bvce2:

Click to download the PDB-style file with coordinates for d2bvce2.
(The format of our PDB-style files is described here.)

Timeline for d2bvce2: