![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (5 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries) |
![]() | Domain d2bvcd2: 2bvc D:105-478 [129250] Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1 automated match to d1f52a2 complexed with adp, cl, mg, p3s |
PDB Entry: 2bvc (more details), 2.1 Å
SCOPe Domain Sequences for d2bvcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvcd2 d.128.1.0 (D:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d2bvcd2: