Lineage for d2bvcc2 (2bvc C:105-478)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1430621Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1430622Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1430870Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 1430871Protein automated matches [227028] (5 species)
    not a true protein
  7. 1430913Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)
  8. 1430922Domain d2bvcc2: 2bvc C:105-478 [129248]
    Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
    automated match to d1f52a2
    complexed with adp, cl, mg, p3s

Details for d2bvcc2

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d2bvcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvcc2 d.128.1.0 (C:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d2bvcc2:

Click to download the PDB-style file with coordinates for d2bvcc2.
(The format of our PDB-style files is described here.)

Timeline for d2bvcc2: