SCOPe 2.08: Domain d2bvcc2: 2bvc C:105-478

Lineage for d2bvcc2 (2bvc C:105-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)

8. Domain d2bvcc2: 2bvc C:105-478 [129248]
   Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
   automated match to d1f52a2
   complexed with adp, cl, mg, p3s

Details for d2bvcc2

PDB Entry: 2bvc, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic

PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d2bvcc2:

Sequence; same for both SEQRES and ATOM records:

>d2bvcc2 d.128.1.0 (C:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d2bvcc2:

• d2bvcc2 first appeared in SCOP 1.73
  
• d2bvcc2 appears in SCOPe 2.07