![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (4 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries) |
![]() | Domain d2bvcc1: 2bvc C:4-104 [129247] Other proteins in same PDB: d2bvca2, d2bvcb2, d2bvcc2, d2bvcd2, d2bvce2, d2bvcf2 automated match to d1f52a1 complexed with adp, cl, mg, p3s |
PDB Entry: 2bvc (more details), 2.1 Å
SCOPe Domain Sequences for d2bvcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvcc1 d.15.9.0 (C:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs ihesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d2bvcc1: