SCOP 1.73: Domain d2bvcc1: 2bvc C:5-104

Lineage for d2bvcc1 (2bvc C:5-104)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)

8. Domain d2bvcc1: 2bvc C:5-104 [129247]
   Other proteins in same PDB: d2bvca2, d2bvcb2, d2bvcc2, d2bvcd2, d2bvce2, d2bvcf2
   automatically matched to d1htoa1
   complexed with adp, cl, mg, p3s

Details for d2bvcc1

PDB Entry: 2bvc, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic

PDB Compounds: (C:) glutamine synthetase 1

SCOP Domain Sequences for d2bvcc1:

Sequence; same for both SEQRES and ATOM records:

>d2bvcc1 d.15.9.1 (C:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d2bvcc1:

• d2bvcc1 is new in SCOP 1.73
  
• d2bvcc1 appears in SCOP 1.75
  
• d2bvcc1 appears in the current release, SCOPe 2.08