Lineage for d2bvcb2 (2bvc B:105-478)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217886Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1217887Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1217888Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 1217889Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 1217890Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries)
  8. 1217892Domain d2bvcb2: 2bvc B:105-478 [129246]
    Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
    automatically matched to d1htoa2
    complexed with adp, cl, mg, p3s

Details for d2bvcb2

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (B:) glutamine synthetase 1

SCOPe Domain Sequences for d2bvcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvcb2 d.128.1.1 (B:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d2bvcb2:

Click to download the PDB-style file with coordinates for d2bvcb2.
(The format of our PDB-style files is described here.)

Timeline for d2bvcb2: