Lineage for d2bv3a5 (2bv3 A:600-688)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206180Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 1206181Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1206230Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 1206231Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 1206233Domain d2bv3a5: 2bv3 A:600-688 [129241]
    Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a3
    automatically matched to d1dar_4
    complexed with gnp, mg; mutant

Details for d2bv3a5

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqekli

SCOPe Domain Coordinates for d2bv3a5:

Click to download the PDB-style file with coordinates for d2bv3a5.
(The format of our PDB-style files is described here.)

Timeline for d2bv3a5: