Lineage for d2bv3a3 (2bv3 A:479-599)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891700Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1891730Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 1891731Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. 1891732Domain d2bv3a3: 2bv3 A:479-599 [129239]
    Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a4, d2bv3a5
    automatically matched to d1dar_3
    complexed with gnp, mg; mutant

Details for d2bv3a3

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
pqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkey
ipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgd
p

SCOPe Domain Coordinates for d2bv3a3:

Click to download the PDB-style file with coordinates for d2bv3a3.
(The format of our PDB-style files is described here.)

Timeline for d2bv3a3: