SCOPe 2.08: Domain d2bv3a2: 2bv3 A:7-282

Lineage for d2bv3a2 (2bv3 A:7-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
   has internal nucleotide exchange factor built in as an insertion subdomain

7. Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
   residues 160-252 comprise insertion subdomain

8. Domain d2bv3a2: 2bv3 A:7-282 [129238]
   Other proteins in same PDB: d2bv3a1, d2bv3a3, d2bv3a4, d2bv3a5
   automatically matched to d1dar_2
   complexed with gnp, mg; mutant
   has additional subdomain(s) that are not in the common domain

Details for d2bv3a2

PDB Entry: 2bv3, 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a2:

Sequence, based on SEQRES records:

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
ydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergitit
aavttcfwkdhriniidapghvdftieversmrvldgaivvfdssqgvepqsetvwrqae
kykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkay
tygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelvaai
rkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records):

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
ydlkrlrnigiaahidagktttterilyytgrihkrgititaavttcfwkdhriniidap
ghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgad
lwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeey
ldqareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalk
nkgvqllldavvdylps

Timeline for d2bv3a2:

• d2bv3a2 first appeared in SCOP 1.73
  
• d2bv3a2 appears in SCOPe 2.07