SCOPe 2.06: Domain d2buhc2: 2buh C:254-406

Lineage for d2buhc2 (2buh C:254-406)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
   Uniprot P14926

8. Domain d2buhc2: 2buh C:254-406 [129209]
   automated match to d1fj4a2
   complexed with nh4

Details for d2buhc2

PDB Entry: 2buh, 1.9 Å

PDB Description: e. coli beta-ketoacyl (acyl carrier protein) synthase i, 120 k

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2buhc2:

Sequence; same for both SEQRES and ATOM records:

>d2buhc2 c.95.1.1 (C:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d2buhc2:

• d2buhc2 first appeared in SCOP 1.73
  
• d2buhc2 appears in SCOPe 2.05
  
• d2buhc2 appears in SCOPe 2.07
  
• d2buhc2 appears in the current release, SCOPe 2.08