Lineage for d2btot1 (2bto T:23-125)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 699045Protein Thioredoxin [52835] (12 species)
  7. 699070Species Escherichia coli [TaxId:562] [52836] (29 PDB entries)
  8. 699088Domain d2btot1: 2bto T:23-125 [129156]
    automatically matched to d1xoa__
    complexed with gtp

Details for d2btot1

PDB Entry: 2bto (more details), 2.5 Å

PDB Description: structure of btuba from prosthecobacter dejongeii
PDB Compounds: (T:) Thioredoxin 1

SCOP Domain Sequences for d2btot1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btot1 c.47.1.1 (T:23-125) Thioredoxin {Escherichia coli [TaxId: 562]}
iihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidqn
pgtapkygirgiptlllfkngevaatkvgalskgqlkefldan

SCOP Domain Coordinates for d2btot1:

Click to download the PDB-style file with coordinates for d2btot1.
(The format of our PDB-style files is described here.)

Timeline for d2btot1: