Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.1: Thioltransferase [52834] (15 proteins) |
Protein Thioredoxin [52835] (12 species) |
Species Escherichia coli [TaxId:562] [52836] (29 PDB entries) |
Domain d2btot1: 2bto T:23-125 [129156] automatically matched to d1xoa__ complexed with gtp |
PDB Entry: 2bto (more details), 2.5 Å
SCOP Domain Sequences for d2btot1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btot1 c.47.1.1 (T:23-125) Thioredoxin {Escherichia coli [TaxId: 562]} iihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidqn pgtapkygirgiptlllfkngevaatkvgalskgqlkefldan
Timeline for d2btot1: