Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
Domain d2bsvd1: 2bsv D:182-276 [129124] Other proteins in same PDB: d2bsva2, d2bsvb1, d2bsvd2, d2bsve1 automatically matched to d1akja1 |
PDB Entry: 2bsv (more details), 1.6 Å
SCOP Domain Sequences for d2bsvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsvd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwep
Timeline for d2bsvd1:
View in 3D Domains from other chains: (mouse over for more information) d2bsva1, d2bsva2, d2bsvb1, d2bsve1 |