Lineage for d2bsud1 (2bsu D:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654615Domain d2bsud1: 2bsu D:182-276 [129118]
    Other proteins in same PDB: d2bsua2, d2bsub1, d2bsud2, d2bsue1
    automatically matched to d1akja1

Details for d2bsud1

PDB Entry: 2bsu (more details), 1.6 Å

PDB Description: t cell cross-reactivity and conformational changes during tcr engagement
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2bsud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsud1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d2bsud1:

Click to download the PDB-style file with coordinates for d2bsud1.
(The format of our PDB-style files is described here.)

Timeline for d2bsud1:

  • d2bsud1 is new in SCOP 1.73
  • d2bsud1 does not appear in SCOP 1.75