SCOPe 2.07: Domain d2bsta2: 2bst A:1-181

Lineage for d2bsta2 (2bst A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d2bsta2: 2bst A:1-181 [129113]
   Other proteins in same PDB: d2bsta1, d2bstb2, d2bstb3
   automatically matched to d1m6oa2

Details for d2bsta2

PDB Entry: 2bst, 2.1 Å

PDB Description: crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705

PDB Compounds: (A:) hla class I histocompatibility antigen, b-27 alpha chain precursor

SCOPe Domain Sequences for d2bsta2:

Sequence; same for both SEQRES and ATOM records:

>d2bsta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d2bsta2:

• d2bsta2 first appeared in SCOP 1.73
  
• d2bsta2 appears in SCOPe 2.06
  
• d2bsta2 appears in the current release, SCOPe 2.08