Lineage for d2bsta2 (2bst A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198225Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
    Uniprot P30481 25-300
  8. 1198235Domain d2bsta2: 2bst A:1-181 [129113]
    Other proteins in same PDB: d2bsta1, d2bstb_
    automatically matched to d1m6oa2

Details for d2bsta2

PDB Entry: 2bst (more details), 2.1 Å

PDB Description: crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705
PDB Compounds: (A:) hla class I histocompatibility antigen, b-27 alpha chain precursor

SCOPe Domain Sequences for d2bsta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d2bsta2:

Click to download the PDB-style file with coordinates for d2bsta2.
(The format of our PDB-style files is described here.)

Timeline for d2bsta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bsta1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bstb_