Lineage for d2bsqf1 (2bsq F:2-66)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998574Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1998575Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1998734Family a.43.1.8: Trafficking protein A-like [140550] (1 protein)
  6. 1998735Protein Trafficking protein A [140551] (1 species)
  7. 1998736Species Neisseria gonorrhoeae [TaxId:485] [140552] (2 PDB entries)
    Uniprot Q5F881 2-70
  8. 1998742Domain d2bsqf1: 2bsq F:2-66 [129103]
    Other proteins in same PDB: d2bsqa1, d2bsqa2, d2bsqb1, d2bsqb2, d2bsqc1, d2bsqc2, d2bsqd1, d2bsqd2
    automatically matched to 2BSQ E:2-70
    protein/DNA complex

Details for d2bsqf1

PDB Entry: 2bsq (more details), 3 Å

PDB Description: fitab bound to dna
PDB Compounds: (F:) trafficking protein a

SCOPe Domain Sequences for d2bsqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsqf1 a.43.1.8 (F:2-66) Trafficking protein A {Neisseria gonorrhoeae [TaxId: 485]}
asvvirnlseathnaikfraraagrsteaeirlildniakaqqtvrlgsmlasigqeigg
veled

SCOPe Domain Coordinates for d2bsqf1:

Click to download the PDB-style file with coordinates for d2bsqf1.
(The format of our PDB-style files is described here.)

Timeline for d2bsqf1: