Lineage for d2bs9g2 (2bs9 G:14-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830612Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 2830613Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)
    Uniprot Q9ZFM2 15-361
  8. 2830628Domain d2bs9g2: 2bs9 G:14-360 [129075]
    Other proteins in same PDB: d2bs9a1, d2bs9b1, d2bs9c1, d2bs9d1, d2bs9e1, d2bs9f1, d2bs9g1, d2bs9h1
    automated match to d2bs9a2
    complexed with ca

Details for d2bs9g2

PDB Entry: 2bs9 (more details), 2.2 Å

PDB Description: Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus
PDB Compounds: (G:) beta-xylosidase

SCOPe Domain Sequences for d2bs9g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs9g2 c.1.8.3 (G:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

SCOPe Domain Coordinates for d2bs9g2:

Click to download the PDB-style file with coordinates for d2bs9g2.
(The format of our PDB-style files is described here.)

Timeline for d2bs9g2: