SCOP 1.75: Domain d2bs9d1: 2bs9 D:4-13,D:361-502

Lineage for d2bs9d1 (2bs9 D:4-13,D:361-502)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Beta-D-xylosidase [101926] (2 species)
   glycosyl hydrolase family 39

7. Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries)
   Uniprot Q9ZFM2 5-14,362-503

8. Domain d2bs9d1: 2bs9 D:4-13,D:361-502 [129068]
   Other proteins in same PDB: d2bs9a2, d2bs9b2, d2bs9c2, d2bs9d2, d2bs9e2, d2bs9f2, d2bs9g2, d2bs9h2
   automatically matched to 2BS9 A:4-13,A:361-502
   complexed with ca

Details for d2bs9d1

PDB Entry: 2bs9, 2.2 Å

PDB Description: Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus

PDB Compounds: (D:) beta-xylosidase

SCOP Domain Sequences for d2bs9d1:

Sequence; same for both SEQRES and ATOM records:

>d2bs9d1 b.71.1.2 (D:4-13,D:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]}
vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesav
fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv
lsknevtlieieqvrdetstyvglddgeitsys

Timeline for d2bs9d1:

• d2bs9d1 first appeared in SCOP 1.73
  
• d2bs9d1 appears in SCOPe 2.01
  
• d2bs9d1 appears in the current release, SCOPe 2.08