Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein Fumarate reductase [46981] (2 species) |
Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries) |
Domain d2bs4a1: 2bs4 A:458-656 [129052] Other proteins in same PDB: d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4e2, d2bs4f_ automated match to d1e7pa1 complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2bs4 (more details), 2.76 Å
SCOPe Domain Sequences for d2bs4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs4a1 a.7.3.1 (A:458-656) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal mpyelpakykarnerlgdk
Timeline for d2bs4a1: