Lineage for d2brrl1 (2brr L:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782778Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 782782Domain d2brrl1: 2brr L:1-107 [129011]
    Other proteins in same PDB: d2brrh1, d2brrl2, d2brrx2, d2brry1
    automatically matched to d1hzhl1
    complexed with acy, nh2, so4

Details for d2brrl1

PDB Entry: 2brr (more details), 1.95 Å

PDB Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)
PDB Compounds: (L:) mn20b9.34 anti-p1.4 antibody, fab light chain

SCOP Domain Sequences for d2brrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brrl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleik

SCOP Domain Coordinates for d2brrl1:

Click to download the PDB-style file with coordinates for d2brrl1.
(The format of our PDB-style files is described here.)

Timeline for d2brrl1: